PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC02G33710.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GATA
Protein Properties Length: 414aa    MW: 43539 Da    PI: 5.4467
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC02G33710.3genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA56.15.1e-18331364134
             GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                      C++C+  kTp+WR gp g+ktLCnaCG++y++ +
  OPUNC02G33710.3 331 CTHCQIEKTPQWRAGPLGPKTLCNACGVRYKSGR 364
                      *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF577161.33E-14324387No hitNo description
PROSITE profilePS5011411.082325361IPR000679Zinc finger, GATA-type
SMARTSM004011.6E-15325375IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.103.3E-14329362IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.86E-14330387No hitNo description
PROSITE patternPS003440331356IPR000679Zinc finger, GATA-type
PfamPF003201.1E-15331364IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 414 aa     Download sequence    Send to blast
MAGVGFVEDM LREQSLLEAT CGDLFDHIDD LLDFPKEESA ADVLLLDAPA PGSPLSSRII  60
GGHVAMAAAA PPPPPQMMAL PPPPAPAKDD ASALFDAAGA LGAEVFDRKD AHIGSCDELD  120
MDMEWLSELF DDGTIPHEPS FPGANCAAPI KASALTANAG VVLPDKMEEA LFRSSSPISV  180
LEHSGFNVAT NGGSSSSSSS SASSSSESFS GSGRAWSAPV SPRPEPPVLV IPARARSKRS  240
RPSAFPAVRG APAATETTIL VPTPMYSSTS SHSDPESIAE SNPHPPPMKK KKKAKKPAAP  300
AASDAEADAD ADADYEEGGA LALPPGTVRR CTHCQIEKTP QWRAGPLGPK TLCNACGVRY  360
KSGRLFPEYR PAASPTFVPS IHSNSHKKVV EMRQKATRTA DQSCDLLQYI RRRD
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00130DAPTransfer from AT1G08010Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8289650.0CT828965.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCFA219J10, full insert sequence.
GenBankCT8289660.0CT828966.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCFA222D18, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015626108.10.0PREDICTED: GATA transcription factor 11
RefseqXP_015626107.10.0PREDICTED: GATA transcription factor 11
TrEMBLA0A0E0K6J60.0A0A0E0K6J6_ORYPU; Uncharacterized protein
TrEMBLA0A0E0K6J80.0A0A0E0K6J8_ORYPU; Uncharacterized protein
STRINGORGLA02G0317800.10.0(Oryza glaberrima)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54810.26e-37GATA family protein